General Information

  • ID:  hor005366
  • Uniprot ID:  P09680
  • Protein name:  Gastric inhibitory polypeptide (GIP) (Glucose-dependent insulinotropic polypeptide)
  • Gene name:  GIP
  • Organism:  Bos taurus (Bovine)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0009749 response to glucose; GO:0042304 regulation of fatty acid biosynthetic process; GO:0050796 regulation of insulin secretion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWIHNITQ
  • Length:  42
  • Propeptide:  YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWIHNITQ
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  GIPR
  • Target Unid:  E1B8G5
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P09680-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P09680-F1.pdbhor005366_AF2.pdbhor005366_ESM.pdb

Physical Information

Mass: 569212 Formula: C225H341N59O66S
Absent amino acids: CP Common amino acids: I
pI: 7.53 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 15
Hydrophobicity: -56.19 Boman Index: -7577
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 79.05
Instability Index: 3790.48 Extinction Coefficient cystines: 13980
Absorbance 280nm: 340.98

Literature

  • PubMed ID:  6391923
  • Title:  A novel form of gastric inhibitory polypeptide (GIP) isolated from bovine intestine using a radioreceptor assay. Fragmentation with staphylococcal protease results in GIP1-3 and GIP4-42, fragmentation with enterokinase in GIP1-16 and GIP17-42.